PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G129600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 228aa    MW: 26809.6 Da    PI: 4.6899
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G129600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-17855148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W +eEde+l  +v+++G ++W++Iar  g++R++k+c++rw++yl
  Aqcoe1G129600.1.p  8 KGPWLEEEDERLTTYVALMGERRWDSIARVSGLRRSGKSCRLRWLNYL 55
                       79********************************************97 PP

2Myb_DNA-binding43.95.4e-1463106348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         + +eE+  ++++ +++G++ W++Iar+++ gRt++++k++w+++l
  Aqcoe1G129600.1.p  63 QMNAEEECVILQLQERWGNK-WSKIARRLP-GRTDNEIKNYWRTHL 106
                        56799***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.229359IPR017930Myb domain
SMARTSM007177.4E-15757IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-267102IPR009057Homeodomain-like
PfamPF002493.6E-15855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-21962IPR009057Homeodomain-like
CDDcd001677.00E-101055No hitNo description
SMARTSM007173.3E-1360108IPR001005SANT/Myb domain
PROSITE profilePS5129418.73360110IPR017930Myb domain
PfamPF002494.6E-1262106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2163109IPR009057Homeodomain-like
CDDcd001671.02E-964106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MQEEIMRKGP WLEEEDERLT TYVALMGERR WDSIARVSGL RRSGKSCRLR WLNYLRPDLK  60
HGQMNAEEEC VILQLQERWG NKWSKIARRL PGRTDNEIKN YWRTHLRKKT QAQEQEKLQR  120
ELQNASSTPD DQSLQTNSSD YQDSGMEDIL ITPEHTVNAF ESSEYPFAAS PYENCLSDWI  180
SETMHDEEAL KHQQEYNVFD TWSYNPAWPS GDGDFWPGLL WDTQQSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-25611025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002265893.24e-80PREDICTED: myb-related protein 305
SwissprotQ9LX823e-52MYB48_ARATH; Transcription factor MYB48
TrEMBLA5BED71e-79A5BED7_VITVI; Putative uncharacterized protein
STRINGBra006977.1-P2e-61(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.19e-64myb domain protein 27